PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000514115
Common NameLOC103407650, WRKY13
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 572aa    MW: 62507.9 Da    PI: 7.3085
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000514115genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY106.31.5e-33231288260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDg+nWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d++++ei+Y+g+Hnh+k
  MDP0000514115 231 DDGFNWRKYGQKQVKGSENPRSYYKCTYPNCPTKKKVERSL-DGQITEIVYKGNHNHPK 288
                    8****************************************.***************85 PP

2WRKY105.52.7e-33403461159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct +gCpv+k+ver+++d ++v++tYeg+Hnh+
  MDP0000514115 403 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNPGCPVRKHVERASHDIRAVITTYEGKHNHD 461
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-28223289IPR003657WRKY domain
SuperFamilySSF1182902.48E-25229289IPR003657WRKY domain
SMARTSM007745.2E-37230288IPR003657WRKY domain
PfamPF031061.2E-25231287IPR003657WRKY domain
PROSITE profilePS5081123.456231289IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.1E-37388463IPR003657WRKY domain
SuperFamilySSF1182903.4E-29395463IPR003657WRKY domain
PROSITE profilePS5081138.561398463IPR003657WRKY domain
SMARTSM007743.7E-39403462IPR003657WRKY domain
PfamPF031061.3E-25404461IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 572 aa     Download sequence    Send to blast
MASSSGSLET SANSHSAAFT FSTHPFMTNS FSDLLDAGTD EYSNPPRYIG QGGLSDRIAE  60
RTGSGVPKFK SLPPPSLPIS PPSISPSSYF AIPPGLSPAE LLDSPVLLNA SNTLPSPTTG  120
SFAARGAFNW KNNQQNVKQE SKNHSDFSFQ TQARPPISSS SSMFQSSNTS IQTTQEQACN  180
NNYFQAQELP KQEYGSVQTL SSELTTKTLQ SNAPANGGFH QQAQTLSRKS DDGFNWRKYG  240
QKQVKGSENP RSYYKCTYPN CPTKKKVERS LDGQITEIVY KGNHNHPKPQ NPRKSSSNSH  300
AIHALNPTNT NEIPDQTYAN HGNSQMDSIG TPEHSSISIG DDDFEQSSQR SKSGGGEEFD  360
EDEPNAKXWK NEADHNEGIS APGNRTVREP RVVVQTTSDI DILDDGYRWR KYGQKVVKGN  420
PNPRSYYKCT NPGCPVRKHV ERASHDIRAV ITTYEGKHNH DVPAARGSGS HAAVNRPIPN  480
NNNNVASAMR PITHHTNNSA NTNSVQNLRQ PTSEGQAPFS LEMLQSPGSY GFVGFDGNSV  540
GSYMNQTQLS DIFSKAKEEP RDDAFFESLL C*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-38231464878Probable WRKY transcription factor 4
2lex_A6e-38231464878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158570.0cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008344767.10.0PREDICTED: probable WRKY transcription factor 26
TrEMBLD9ZJF20.0D9ZJF2_MALDO; WRKY domain class transcription factor
STRINGGLYMA14G38010.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-112WRKY DNA-binding protein 33